Cangitoxin

Last updated

Cangitoxin, also known as CGTX or CGX, is a toxin purified from the venom of the sea anemone Bunodosoma cangicum, which most likely acts by prolonging the inactivation of voltage-gated sodium channels (NaV channels).

Contents

Sources

Cangitoxin is a polypeptide isolated from the venom of Bunodosoma cangicum, a common sea anemone species found in the intertidal zone during low tides on the coastal reefs of the Brazilian seashore. [1] [2]

Chemistry

Structure

Cangitoxin belongs to the type 1 class sea anemone toxins, consisting of long polypeptides with short anti-parallel β–sheets and three disulfide bonds. [3] Cangitoxin is a 4958 Da peptide, with the primary structure GVACRCDSDGPTVRGNSLSGTLWLTGGCPSGWHNCRGSGPFIGYCCKK [1] [4] and disulfide bonds Cys4-Cys45, Cys6-Cys35, and Cys28-Cys46. It contains 48 amino acid residues.

Substitution of the 16th amino acid, asparagine (N), into an aspartic acid (D) is named cangitoxin-II (CGTX-II). Cangitoxin-III (CGTX-III) contains in addition to the previous substitution, a replacement of the 14th amino acid, arginine (R), into histidine (H). [4]

Homology

Cangitoxin is to varying degrees homologous to the other sea anemone toxins. The most prominent is the homology to the type 1 class sea anemone toxins (85%). The homology of cangitoxin to the type 2 and 3 class sea anemone toxins is less, respectively 50% and 30%. The major neurotoxin BcIII (BcIII) isolated from Bunodosoma caissarum is homologous to cangitoxin. It has two homologous amino acid substitutions (S17T and S19T) and one non-homologous substitution (V13S). This makes it 94% identical and 98% homologous to cangitoxin. [1]

Target and mode of action

Sea anemone toxins act on voltage-gated sodium channels (NaV1.1, NaV1.2, NaV1.4, NaV1.5, NaV1.6, NaV1.7) and depending on their affinity to a specific isoform, they mainly act on cardiac or neuronal voltage-gated sodium channels. [1] [5] Sea anemone toxins act at the receptor site 3. [6] On the basis of its sequence homology, cangitoxin most likely acts on the same receptor site of the previously mentioned sodium channels. Neurotoxin receptor site 3 is localized on the extracellular side of the IVS4 transmembrane segment. The S4 segments of sodium channels move outward when the membrane depolarizes. [6]

According to its sequence homology, it is likely that cangitoxin prolongs the inactivation of the voltage-gated sodium channels by binding on the external side of the plasma membrane, thereby preventing the outward movement of the IVS4 transmembrane segment. This blockage prevents the conformational change that is essential for inactivation. [6] The prolongation of the inactivation has been demonstrated in experiments in which the effect of cangitoxin-II and –III on the NaV1.1 channel was investigated. [4]

Toxicity

Intrahippocampal injection of 8 μg of cangitoxin in rats has strong behavioral effects, leading to akinesia interchanging with facial automatisms and head tremor, salivation, rearing, jumping, barrel-rolling, wet dog shakes and forelimb clonic movements. In addition, convulsions occur which gradually increase in duration, leading to a status epilepticus. The electroencephalogram shows spike-and-wave, which is typically seen during epileptic convulsions. [1]

Lower intrahippocampal doses of cangitoxin (2-4 μg) do not lead to either behavioral or EEG alterations in rats. Higher doses of cangitoxin (12-16 μg) induce severe tonic-clonic convulsions, leading to death. [1]

Related Research Articles

Pompilidotoxins (PMTXs) are toxic substances that can only be found in the venom of several solitary wasps. This kind of wasp uses their venom to offensively capture prey and is relatively harmless to humans. This is in stark contrast to social insects that defend themselves and their colonies with their venom.

Birtoxin is a neurotoxin from the venom of the South African Spitting scorpion. By changing sodium channel activation, the toxin promotes spontaneous and repetitive firing much like pyrethroid insecticides do

AETX refers to a group of polypeptide neurotoxins isolated from the sea anemone Anemonia erythraea that target ion channels, altering their function. Four subtypes have been identified: AETX I, II, III and K, which vary in their structure and target.

BmKAEP is a neurotoxin from the venom of the Manchurian scorpion (Mesobuthus martensii). It is a β-toxin, which shift the activation voltage of sodium channels towards more negative potentials.

<i>delta</i>-Palutoxin

delta-Palutoxins (δ-palutoxins) consist of a homologous group of four insect-specific toxins from the venom of the spider Pireneitega luctuosa. They show a high toxicity against Spodoptera litura larvae by inhibiting sodium channels, leading to strong paralytic activity and eventually to the death of the insect.

Hainantoxins (HNTX) are neurotoxins from the venom of the Chinese bird spider Haplopelma hainanum. Hainantoxins specifically inhibit tetrodotoxin-sensitive Voltage-gated sodium channels, thereby causing blockage of neuromuscular transmission and paralysis. Currently, 13 different hainantoxins are known, but only HNTX-I, -II, -III, -IV and -V have been investigated in detail.

Huwentoxins (HWTX) are a group of neurotoxic peptides found in the venom of the Chinese bird spider Haplopelma schmidti. The species was formerly known as Haplopelma huwenum, Ornithoctonus huwena and Selenocosmia huwena. While structural similarity can be found among several of these toxins, HWTX as a group possess high functional diversity.

Halcurin is a polypeptide neurotoxin from the sea anemone Halcurias sp. Based on sequence homology to type 1 and type 2 sea anemone toxins it is thought to delay channel inactivation by binding to the extracellular site 3 on the voltage gated sodium channels in a membrane potential-dependent manner.

Calitoxin, also known as CLX, is a sea anemone neurotoxin produced by the sea anemone Calliactis parasitica. It targets crabs and octopuses, among other invertebrates. Two isoforms have been identified, both of which are formed from precursors stored in the stinging cells of the anemone. Once the toxin is activated and released, it causes paralysis by increasing neurotransmitter release at invertebrate neuromuscular junctions. Along with several other toxins derived from anemones, CLX is useful in ion channel research. Certain structural aspects of calitoxin are dissimilar from sea anemone toxins that also target the sodium ion channels. Other toxins resembling calitoxin function in completely different ways.

CgNa is a peptide toxin isolated from the sea anemone Condylactis gigantea. It causes an increased action potential duration by slowing down the inactivation of tetrodotoxin-sensitive sodium channels.

Kaliseptine (AsKS) is a neurotoxin which can be found in the snakelocks anemone Anemonia viridis. It belongs to a class of sea anemone neurotoxins that inhibits voltage-gated potassium channels.

LmαTX3 is an α-scorpion toxin from Lychas mucronatus. that inhibits fast inactivation of voltage gated sodium-channels (VGSCs).

SHTX is a toxin derived from the sea anemone Stichodactyla haddoni; there are four different subtypes, SHTX I, II, III and IV. SHTX I, II and III can paralyze crabs by acting on potassium channels, while SHTX IV works on sodium channels, and is lethal to crabs.

Kalicludine (AsKC) is a blocker of the voltage-dependent potassium channel Kv1.2 found in the snakeslocks anemone Anemonia viridis, which it uses to paralyse prey.

BcIII

BcIII is a polypeptide sea anemone neurotoxin isolated from Bunodosoma caissarum. It targets the site 3 of voltage-gated sodium channels, thus mainly prolonging the inactivation time course of the channel.

ATX-II, also known as neurotoxin 2, Av2, Anemonia viridis toxin 2 or δ-AITX-Avd1c, is a neurotoxin derived from the venom of the sea anemone Anemonia sulcata. ATX-II slows down the inactivation of different voltage-gated sodium channels, including Nav1.1 and Nav1.2, thus prolonging action potentials.

LmαTX5 is an α-scorpion toxin which inhibits the fast inactivation of voltage-gated sodium channels. It has been identified through transcriptome analysis of the venom gland of Lychas mucronatus, also known as the Chinese swimming scorpion – a scorpion species which is widely distributed in Southeast Asia.

<span class="mw-page-title-main">BscTx3</span>

BcsTx3, also known as Kappa-actitoxin-Bsc4a, is a neurotoxin that blocks voltage-gated potassium channel (Kv1/KCNA). It is purified from the venom of Bunodosoma caissarum.

<span class="mw-page-title-main">Versutoxin</span> Spider toxin

Delta hexatoxin Hv1 is a neurotoxic component found in the venom of the Australian funnel web spider.

Tb1 is a neurotoxin that is naturally found in the venom of the Brazilian scorpion Tityus bahiensis. Presumably by acting on voltage-gated sodium channels, it triggers excessive glutamate release, which can lead to both behavioral and electrographic epileptiform alterations, as well as neuronal injury.

References

  1. 1 2 3 4 5 6 Cunha, RB; Santana, ANC; Amaral, PC; Carvalho, MDF; Carvalho, DMF; Cavalheiro, EA; Maigret, B; Ricart, CAO; Cardi, BA; Sousa, MV; Calvalho, KM (2005). "Primary structure, behavioral and electroencephalographic effects of an epileptogenic peptide from the sea anemone Bunodosoma cangicum". Toxicon. 45 (2): 207–217. doi:10.1016/j.toxicon.2004.10.011. PMID   15626370.
  2. ↑ Dias, TBJ; Moura, E; Guedes, S; Damasceno, LC (2007). "Predation of the sea anemone Bunodosoma cangicum Corrêa, 1964 (Cnidaria, Anthozoa, Actiniidae) on a swimming crab Callinectes sp. Stimpson, 1860 (Decapoda, Brachyura, Portunidae)" (PDF). Panamajas. 2 (3): 2.
  3. ↑ Treptow, WL; Sousa, MV; Carvalho, KMC; Maigret, B (2003). "The structure of a new anemone toxin: a molecular modeling study of cangitoxin". J. Mol. Struct. 624 (1–3): 87–95. doi:10.1016/S0166-1280(02)00713-3.
  4. 1 2 3 Zaharenko, AJ; Ferreira Jr., WA; de Oliveira, JS; Konno, K; Richardson, M; Schiavon, E; Wanke, E; de Freitas, JC (2008). "Revisiting cangitoxin, a sea anemone peptide: purification and characterization of cangitoxins II and III from the venom of Bunodosoma cangicum". Toxicon. 51 (7): 1303–1307. doi:10.1016/j.toxicon.2008.01.011. PMID   18342901.
  5. ↑ Oliveira, JS; Redaelli, E; Zaharenko, AJ; Cassulini, RR; Konno, K; Pimenta, DC; Freitas, JC; Clare, JJ; Wanke, E (2004). "Binding specificity of sea anemone toxins to Nav 1.1-1.6 sodium channels: unexpected contributions from differences in the IV/S3-S4 outer loop" (PDF). J Biol Chem. 279 (32): 33323–33335. doi: 10.1074/jbc.M404344200 . PMID   15169781.
  6. 1 2 3 Catterall, WA; Cestele, S; Yarov-Yarovoy, V; Yu, FH; Konoki, K; Scheuer, T (2007). "Voltage-gated ion channels and gating modifier toxins" (PDF). Toxicon. 49 (2): 124–141. doi:10.1016/j.toxicon.2006.09.022. PMID   17239913.
This page is based on this Wikipedia article
Text is available under the CC BY-SA 4.0 license; additional terms may apply.
Images, videos and audio are available under their respective licenses.