BotIT2

Last updated

BotIT2 is a neurotoxin from the scorpion Buthus occitanus tunetanus, which modifies activation and slows down the deactivation of voltage gated sodium channels. [1]

Contents

Source and etymology

BotIT2 is found in the venom of the scorpion Buthus occitanus tunetanus (Bot) [2] and hence named Buthus occitanus tunetanus insect toxin 2 (BotIT2). [3]

Chemistry

Structure

N'—DGYIKGYKGCKITCVINDDYCDTECKAEGGTYGICWKWGLACWCEDLPEDKRWKPETNTC –C'
Fig.1 Amino acid sequence of BotIT2 including N-terminus and C-terminus. [2] [3]

The BotIT2 peptide is composed of 60 amino-acids (Fig. 1) and its C-terminal residue contains a free carboxyl group. The molecular mass of BotIT2 is 6919 Da. [2] [3]

Family

BotIT2 belongs to the Buthidae neurotoxin family. Three main groups are distinguishable in this family: the α-, the β- and the depressant toxins. [4] The BotIT2 has characteristics of all these subgroups. [5] However, BotIT2 is classified as a β-depressant toxin. [3]

Homology

BotIT2 differs from other scorpion toxins not only in its amino acid sequence, but in its effects on activation kinetics of insect sodium channels as well. Similarities are found between BotIT2 and other neurotoxins. For example, the degree of similarity with the α-type and β-type toxins, flaccid-depressive insect toxins and BotIT4 is 30-40%, 60-70%, [1] and 67%, [2] respectively. Despite 67% homogeneity with BotIT4, BotIT4 can be discriminated from BotIT2, by binding two sodium channel sites and having its exclusive depressant electrophysiological function. However, BotIT4 and BotIT2 do share binding characteristics. [1] [6]

Target

BotIT2 binds site 4 of voltage gated sodium channels with low capacity (Bmax = 2.4 ± 0.5 pmol/mg) and high affinity (Kd = 0.3 ± 0.1 nM). [1] Besides its influence in insects, BotIT2 affects neuronal membrane properties of mammals as well, but in a less potent way (see Toxicity). [7]

Mode of action

The effect of BotIT2 was investigated in the giant axon and dorsal unpaired median (DUM) neurons of the American cockroach (Periplaneta americana), to examine its influence on neuronal excitability by means of voltage clamp and current clamp recordings. [2] [8] Application of BotIT2 transforms the fast sodium current into a slow sodium current. [1] [2] The difference in gating modes from fast to slow are caused by changes in structural conformation. The voltage dependence of this slow current does not differ from the dependence of the fast current. However, the kinetics (activation and deactivation) of the current are slowed down by 40-300 times. [8] This slow sodium current induces a depolarization and results in repetitive firing pattern and burst firing in a time-dependent manner. BotIT2 decreases the maximal peak of the fast depolarizing sodium inward current and thus causes a decrease in action potential amplitude. [2] [8]
Together, BotIT2 modifies the kinetics of insect's sodium channel activation, transforms fast sodium currents in slow current and enhances (in DUM) or induces (in the axon) a repetitive firing pattern or burst activity, but of smaller amplitude.

Toxicity

Table 1. Whole charge and toxicity (LD50) of Bot insect toxins in B. Germanica. [2] [9]
Insect toxinWhole chargeToxicity (ng/100 body weight)
BotIT6

+3

10

BotIT4/IT5

-2

110

BotIT3

-3

135

BotIT2 is highly toxic in insects. [1] [2] [9] [8] For instance, injection of BotIT2 into the German cockroach (Blatella Germanica) results in a contraction paralysis effect. [1] [8] Although the toxin induces neurotoxic symptoms in mice too, it is less potent in mammals than in insects [1] [2] (LD50 in mice = 1 μg/20 g; LD50 in B. Germanica = 135 ng/100 mg [1] [8] ). So far, the underlying mechanism of the toxic behavior has not been fully understood. High toxicity of the toxins in animals could be explained by the presence of different toxins in the venom of the Buthus occitanus tunetanus (BotIT1, BotIT4 and BotIT5) which acts collectively to insects. Another possibility might be a cooperative interaction between the toxins in the venom. In general, scorpion toxins bind to ion channels via sites of positive surface potential. The total positive charge of the toxin increases its toxicity. Table 1 indicates whole charge for some Bot insect toxins and their toxicity. BotIT2 its whole charge is negative (-3), like BotIT4/5 (-2), whereas it is positive for BotIT6 (+3). [9] Therefore, BotIT2 is the least potent (LD50= 135) [2] [9] when compared to BotIT4, BotIT5 and BotIT64. [9]


Related Research Articles

<span class="mw-page-title-main">Poneratoxin</span> Paralyzing neurotoxic peptide

Poneratoxin is a paralyzing neurotoxic peptide made by the bullet ant Paraponera clavata. It prevents inactivation of voltage gated sodium channels and therefore blocks synaptic transmission in the central nervous system. Specifically, poneratoxin acts on voltage gated sodium channels in skeletal muscle fibers, causing paralysis, and nociceptive fibers, causing pain. It is rated as a 4 plus on the Schmidt sting pain index, the highest possible rating with that system, and its effects can cause waves of pain up to twelve hours after a single sting. It is additionally being studied for its uses in biological insecticides.

<span class="mw-page-title-main">Scorpion toxin</span>

Scorpion toxins are proteins found in the venom of scorpions. Their toxic effect may be mammal- or insect-specific and acts by binding with varying degrees of specificity to members of the Voltage-gated ion channel superfamily; specifically, voltage-gated sodium channels, voltage-gated potassium channels, and Transient Receptor Potential (TRP) channels. The result of this action is to activate or inhibit the action of these channels in the nervous and cardiac organ systems. For instance, α-scorpion toxins MeuNaTxα-12 and MeuNaTxα-13 from Mesobuthus eupeus are neurotoxins that target voltage-gated Na+ channels (Navs), inhibiting fast inactivation. In vivo assays of MeuNaTxα-12 and MeuNaTxα-13 effects on mammalian and insect Navs show differential potency. These recombinants exhibit their preferential affinity for mammalian and insect Na+ channels at the α-like toxins' active site, site 3, in order to inactivate the cell membrane depolarization faster[6]. The varying sensitivity of different Navs to MeuNaTxα-12 and MeuNaTxα-13 may be dependent on the substitution of a conserved Valine residue for a Phenylalanine residue at position 1630 of the LD4:S3-S4 subunit or due to various changes in residues in the LD4:S5-S6 subunit of the Navs. Ultimately, these actions can serve the purpose of warding off predators by causing pain or to subdue predators.

<i>Buthus occitanus</i> Species of arachnid

Buthus occitanus, the common yellow scorpion, is a species of scorpion in the family Buthidae. It occurs in the Middle East, North Africa and Europe.

Birtoxin is a neurotoxin from the venom of the South African Spitting scorpion. By changing sodium channel activation, the toxin promotes spontaneous and repetitive firing much like pyrethroid insecticides do

Bestoxin is a neurotoxin from the venom of the South African spitting scorpion Parabuthus transvaalicus. Most likely, it targets sodium channel function, thus promoting spontaneous and repetitive neuronal firing. Following injection into mice, it causes non-lethal writhing behaviour.

BmKAEP is a neurotoxin from the venom of the Manchurian scorpion (Mesobuthus martensii). It is a β-toxin, which shift the activation voltage of sodium channels towards more negative potentials.

Babycurus-toxin 1 (BcTx1) is a component of the venom of the east African scorpion Babycurus centrurimorphus. This toxin modifies both the activation and the inactivation properties of insect sodium channels.

<i>Olivierus martensii</i> Species of scorpion

Olivierus martensii is a species of scorpion in the family Buthidae. Its common names include Chinese scorpion, Manchurian scorpion, Chinese armor-tail scorpion and Chinese golden scorpion. Despite its common name, this scorpion is not only found in Manchuria or China, but also in Mongolia and Korea. The record from Japan is doubtful. Its preferred habitat is warm, dry areas with little vegetation. O. martensii can grow to about 6 centimetres (2.4 in) long, with females usually slightly larger, and has a life-span of about 4 to 6 years.

Bukatoxin is an α-scorpion toxin found in the venom of the Chinese scorpion Buthus martensi Karsch. By blocking the inactivation of sodium ion channels, α-scorpion toxins prolong action potentials.

<i>delta</i>-Palutoxin

delta-Palutoxins (δ-palutoxins) consist of a homologous group of four insect-specific toxins from the venom of the spider Pireneitega luctuosa. They show a high toxicity against Spodoptera litura larvae by inhibiting sodium channels, leading to strong paralytic activity and eventually to the death of the insect.

<span class="mw-page-title-main">Androctonus australis hector insect toxin</span>

Androctonus australis hector insect toxin also known as AaHIT is a scorpion toxin which affects voltage-gated sodium channels. Four different insect toxins, namely AaHIT1, AaHIT2, AaHIT4 and AaHIT5, can be distinguished. It targets insects, except AaHIT4, which is also toxic to crustaceans and mammals.

<span class="mw-page-title-main">Cll1</span> Scorpion protein

Toxin Cll1 is a toxin from the venom of the Mexican scorpion Centruroides limpidus limpidus, which changes the activation threshold of sodium channels by binding to neurotoxin binding site 4, resulting in increased excitability.

BotIT6 is a toxin that binds to insect voltage gated sodium channels. It decreases the amplitude of the action potential, leading to paralysis.

Centruroides suffusus suffusus toxin II (CssII) is a scorpion β-toxin from the venom of the scorpion Centruroides suffusus suffusus. CssII primarily affects voltage-gated sodium channels by causing a hyperpolarizing shift of voltage dependence, a reduction in peak transient current, and the occurrence of resurgent currents.

Pi4 is a short toxin from the scorpion Pandinus imperator that blocks specific potassium channels.

LqhIT2 is a long-chain scorpion depressant β-toxin derived from Leiurus quinquestriatus hebraeus. It targets insect voltage-gated sodium channels (Navs) and shifts the voltage dependence of channel activation to a more negative membrane potential.

BmP02, also known as α-KTx 9.1 or Bmkk(6), is a toxin from the Buthus Martensi Karsch (BmK) scorpion. The toxin acts on potassium channels, blocking Kv1.3 and slowing the deactivation of Kv4.2. BmP02 is not toxic to humans or mice.

<span class="mw-page-title-main">Scorpionism in Central America</span>

Scorpionism is defined as the accidental envenomation of humans by toxic scorpions. If the injection of venom in a human results in death, this is defined as scorpionism. This is seen all over the world but is predominantly seen in the tropical and subtropical areas. These areas include Mexico, northern South America and southeast Brazil in the Western hemisphere. In the Eastern hemisphere, scorpionism possess a public health threat in the regions of South Africa, the Middle East, and the Indian subcontinent.


N58A is a peptide depressant β-neurotoxin found in the venom of certain East Asian scorpions. The toxin affects voltage-gated sodium channels, specifically Nav1.8 & Nav1.9 channels.

<span class="mw-page-title-main">Versutoxin</span> Spider toxin

Delta hexatoxin Hv1 is a neurotoxic component found in the venom of the Australian funnel web spider.

References

  1. 1 2 3 4 5 6 7 8 9 Cestèle, Sandrine; Borchani, Lamia; El Ayeb, Mohamed; Rochat, Hervé (1997). "Bot IT2: A new scorpion toxin to study receptor site on insect sodium channels". FEBS Letters. 405 (1): 77–80. doi: 10.1016/S0014-5793(97)00160-9 . PMID   9094428.
  2. 1 2 3 4 5 6 7 8 9 10 11 Borchani, Lamia; Mansuelle, Pascal; Stankiewicz, Maria; Grolleau, Francoise; Cestele, Sandrine; Karoui, Habib; Lapied, Bruno; Rochat, Herve; Pelhate, Marcel; Ayeb, Mohamed (1996). "A New Scorpion Venom Toxin Paralytic to Insects that Affects Na+ Channel Activation". European Journal of Biochemistry. 241 (2): 525–32. doi: 10.1111/j.1432-1033.1996.00525.x . PMID   8917451.
  3. 1 2 3 4 "Beta-insect depressant toxin BotIT6". Uniprot. October 1, 2014.
  4. ↑ Jover, Emmanuel; Couraud, François; Rochat, Hervé (1980). "Two types of scorpion neurotoxins characterized by their binding to two separate receptor sites on rat brain synaptosomes". Biochemical and Biophysical Research Communications. 95 (4): 1607–14. doi:10.1016/S0006-291X(80)80082-9. PMID   7417336.
  5. ↑ Cestele, Sandrine; Kopeyan, Charles; Oughideni, Razika; Mansuelle, Pascal; Granier, Claude; Rochat, Herve (1997). "Biochemical and Pharmacological Characterization of a Depressant Insect Toxin from the Venom of the Scorpion Buthacus arenicola". European Journal of Biochemistry. 243 (1–2): 93–9. doi: 10.1111/j.1432-1033.1997.93_1a.x . PMID   9030726.
  6. ↑ Borchani, Lamia; Stankiewicz, Maria; Kopeyan, Charles; Mansuelle, Pascal; Kharrat, Riadh; Cestèle, Sandrine; Karoui, Habib; Rochat, Hervé; Pelhate, Marcel; El Ayeb, Mohamed (1997). "Purification, structure and activity of three insect toxins from Buthus occitanus tunetanus venom". Toxicon. 35 (3): 365–82. doi:10.1016/S0041-0101(96)00173-0. PMID   9080593.
  7. ↑ Borchani, L.; Kharrat, R.; Karoui, H.; Dellagi, K.; Ayeb, M.El; Stankiewicz, M.; Grolleau, F.; Lapied, B.; Pelhate, M.; Mansuelle, P.; Cestele, S.; Rochat, H. (1995). "Purification and characterization of insect toxins from the venom of the scorpion Buthus occitanus tunetanus". Toxicon. 33 (9): 1120. doi:10.1016/0041-0101(95)93831-E.
  8. 1 2 3 4 5 6 Stankiewicz, M.; Grolleau, F.; Lapied, B.; Borchani, L.; El Ayeb, M.; Pelhate, M. (1996). "Bot IT2, a toxin paralytic to insects from the Buthus occitanus tunetanus venom modifying the activity of insect sodium channels". Journal of Insect Physiology. 42 (4): 397–405. doi:10.1016/0022-1910(95)00120-4.
  9. 1 2 3 4 5 Mejri, Thouraya; Borchani, Lamia; Srairi-Abid, Najet; Benkhalifa, Rym; Cestele, Sandrine; Regaya, Imed; Karoui, Habib; Pelhate, Marcel; Rochat, Hervé; El Ayeb, Mohamed (2003). "BotIT6: A potent depressant insect toxin from Buthus occitanus tunetanus venom". Toxicon. 41 (2): 163–71. doi:10.1016/S0041-0101(02)00246-5. PMID   12565735.
This page is based on this Wikipedia article
Text is available under the CC BY-SA 4.0 license; additional terms may apply.
Images, videos and audio are available under their respective licenses.