The pterobranchia mitochondrial code (translation table 24) is a genetic code used by the mitochondrial genome of Rhabdopleura compacta (Pterobranchia). The Pterobranchia are one of the two groups in the Hemichordata which together with the Echinodermata and Chordata form the three major lineages of deuterostomes. AUA translates to isoleucine in Rhabdopleura as it does in the Echinodermata and Enteropneusta while AUA encodes methionine in the Chordata. The assignment of AGG to lysine is not found elsewhere in deuterostome mitochondria but it occurs in some taxa of Arthropoda. [1] This code shares with many other mitochondrial codes the reassignment of the UGA STOP to tryptophan, and AGG and AGA to an amino acid other than arginine. The initiation codons in Rhabdopleura compacta are ATG and GTG. [1]
Code 24 is very similar to the mitochondrial code 33 for the Pterobranchia. [2]
    AAs  = FFLLSSSSYY**CCWWLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSSKVVVVAAAADDEEGGGG Starts = ---M---------------M---------------M---------------M------------  Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGBases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).
Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V)
| DNA codons | RNA codons | This code (24) | Standard code (1) | |
|---|---|---|---|---|
AGA | AGA | Ser(S) | Arg(R) | |
AGG | AGG | Lys(K) | Arg(R) | |
TGA | UGA | Trp(W) | STOP = Ter(*) | 
Pterobranchia is a class of small worm-shaped animals. They belong to the Hemichordata, and live in secreted tubes on the ocean floor. Pterobranchia feed by filtering plankton out of the water with the help of cilia attached to tentacles. There are about 25 known living pterobranch species in three genera, which are Rhabdopleura, Cephalodiscus, and Atubaria. On the other hand, there are several hundred extinct genera, some of which date from the Cambrian Period.
Amino acid synthesis is the set of biochemical processes by which the amino acids are produced. The substrates for these processes are various compounds in the organism's diet or growth media. Not all organisms are able to synthesize all amino acids. For example, humans can only synthesize 11 of the 20 standard amino acids, and in time of accelerated growth, histidine can be considered an essential amino acid.
The yeast mitochondrial code is a genetic code used by the mitochondrial genome of yeasts, notably Saccharomyces cerevisiae, Candida glabrata, Hansenula saturnus, and Kluyveromyces thermotolerans.
The mold, protozoan, and coelenterate mitochondrial code and the mycoplasma/spiroplasma code is the genetic code used by various organisms, in some cases with slight variations, notably the use of UGA as a tryptophan codon rather than a stop codon.
The invertebrate mitochondrial code is a genetic code used by the mitochondrial genome of invertebrates.
The echinoderm and flatworm mitochondrial code is a genetic code used by the mitochondria of certain echinoderm and flatworm species.
The ascidian mitochondrial code is a genetic code found in the mitochondria of Ascidia.
The alternative flatworm mitochondrial code is a genetic code found in the mitochondria of Platyhelminthes and Nematodes.
The Blepharisma nuclear code is a genetic code found in the nuclei of Blepharisma.
The chlorophycean mitochondrial code is a genetic code found in the mitochondria of Chlorophyceae.
The trematode mitochondrial code is a genetic code found in the mitochondria of Trematoda.
The scenedesmus obliquus mitochondrial code is a genetic code found in the mitochondria of Scenedesmus obliquus.
The Thraustochytrium mitochondrial code is a genetic code found in the mitochondria of labyrinthulid Thraustochytrium aureum. The mitochondrial genome was sequenced by the Organelle Genome Megasequencing Program.
The pachysolen tannophilus nuclear code is a genetic code found in the ascomycete fungus Pachysolen tannophilus.
The karyorelictid nuclear code is a genetic code used by the nuclear genome of the Karyorelictea ciliate Parduczia sp.
The Condylostoma nuclear code is a genetic code used by the nuclear genome of the heterotrich ciliate Condylostoma magnum.
The Mesodinium nuclear code is a genetic code used by the nuclear genome of the ciliates Mesodinium and Myrionecta.
The peritrich nuclear code is a genetic code used by the nuclear genome of the peritrich ciliates Vorticella and Opisthonecta.
The Blastocrithidia nuclear code is a genetic code used by the nuclear genome of the trypanosomatid genus Blastocrithidia.
The Cephalodiscidae mitochondrial code is a genetic code used by the mitochondrial genome of Cephalodiscidae (Pterobranchia). The Pterobranchia are one of the two groups in the Hemichordata which together with the Echinodermata and Chordata form the major clades of deuterostomes.
This article incorporates text from the United States National Library of Medicine, which is in the public domain. [3]