Yeast mitochondrial code

The yeast mitochondrial code (translation table 3) is a genetic code used by the mitochondrial genome of yeasts, notably Saccharomyces cerevisiae , Candida glabrata , Hansenula saturnus , and Kluyveromyces thermotolerans . ^[1]

The code

    AAs = FFLLSSSSYY**CCWWTTTTPPPPHHQQRRRRIIMMTTTTNNKKSSRRVVVVAAAADDEEGGGG

Starts = ---M---------------M---------------M---------------M------------

  Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG

 Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG

 Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V).

Differences from the standard code

DNA codons	RNA codons	This code (3)		Standard code (1)
ATA	AUA	Met (M)		Ile (I)
CTT	CUU	Thr (T)		Leu (L)
CTC	CUC	Thr(T)		Leu(L)
CTA	CUA	Thr(T)		Leu(L)
CTG	CUG	Thr(T)		Leu(L)
TGA	UGA	Trp(W)		STOP = Ter(*)
CGA	CGA	Absent		Arg(R)
CGC	CGC	Absent		Arg(R)

• The remaining CGN codons are rare in Saccharomyces cerevisiae ^[2] and absent in Candida glabrata .
• The AUA codon is common in the gene var1 coding for the single mitochondrial ribosomal protein, but rare in genes encoding the enzymes.
• The coding assignments of the AUA (Met or Ile) and CUU (possibly Leu, not Thr) are uncertain in Hansenula saturnus .
• The coding assignment of Thr to CUN is uncertain in Kluyveromyces thermotolerans .

See also

• List of genetic codes

References

This article incorporates text from the United States National Library of Medicine, which is in the public domain. ^[3]

1. Clark-Walker, G. D.; Weiller, G. F. (1994). "The structure of the small mitochondrial DNA of Kluyveromyces thermotolerans is likely to reflect the ancestral gene order in fungi". Journal of Molecular Evolution. 38 (6): 593–601. Bibcode:1994JMolE..38..593C. doi:10.1007/bf00175879. PMID   8083884. S2CID   10510397.
2. Susan G. Bonitz, Roberta Berlani, Gloria Coruzzi, May Li, Giuseppe Macino, Francisco G. Nobrega, Marina P. Nobrega, Arbara E. Thalenfeld and Alexander Tzagoloff (June 1980). "Codon recognition rules in yeast mitochondria" (PDF). Proc. Natl. Acad. Sci. USA. 77 (6): 3167–3170. Bibcode:1980PNAS...77.3167B. doi: 10.1073/pnas.77.6.3167 . PMC   349575 . PMID   6997870.
3. Elzanowski A, Ostell J, Leipe D, Soussov V. "The Genetic Codes". Taxonomy browser. National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine. Retrieved 30 April 2015.