| DRC7 | |||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Identifiers | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | DRC7 , C16orf50, CCDC135, CFAP50, FAP50, Coiled-coil domain-containing protein 135, dynein regulatory complex subunit 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| External IDs | MGI: 2685616; HomoloGene: 12996; GeneCards: DRC7; OMA:DRC7 - orthologs | ||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||
| Wikidata | |||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||
Coiled-coil domain-containing protein 135, also known as CCDC135, is a protein that in humans is encoded by the CCDC135 gene. [5] [6]
CCDC90B is located on chromosome 16 in humans. It is neighbored by: [7]
This protein is characterized by the presence of two domains. [8]
KKQQEIRAQEKKRLR
CAQFVSDFLTMVPLPDPLKPPSHLYSSTTVLKYQKGNCFDFSTLLCSMLIGSGYDAYCVNGYGSLDLCHMDLTREVCPLTVKPKETIKKEEK VLPKKYTIKPPRDLCSRFEQEQEVKKQQEIRAQEKKRLREEEERLMEAEKAKPDALHGLRVHSWVLVL
The protein has 17 predicted alpha helices sites, a characteristic of coiled-coil proteins, and 1 predicted beta-pleated sheet. The following image shows the predicted regions of alpha helices and beta pleated sheets by two programs STRAP [9] and Quickphyre: [10] Note: the consensus secondary structures are shown. This was carried out by constructing a multiple sequence alignment of the proteins with their secondary structures (as shown below). The predicted regions were then cross checked with the Quickphyre Archived 30 April 2017 at the Wayback Machine Program.
LRRC57 is exceedingly well conserved, as shown in the sequence annotation to the right. The sequence annotation was created using 20 orthologs shown in the table below and was prepared using ClustalX2 [11] and ClustalW (a tool at Biology Workbench). [12]
The following table provides a few details on orthologs of the human version of CCDC135. These orthologs were gathered from BLAT. [13] and BLAST searches [14]
| Species | Organism common name | NCBI accession | Sequence identity | Sequence similarity | Length (AAs) | Gene common name |
|---|---|---|---|---|---|---|
| Homo sapiens | Human | NP_115645.4 | 100% | 100% | 874 | Homo sapiens coiled-coil domain containing 135 (CCDC135) |
| Macaca mulatta | Rhesus monkey | XP_001100628.1 | 96% | 98% | 830 | Predicted: similar to chromosome 16 open reading frame 50 |
| Bos taurus | Cow | NP_001033120.1 | 86% | 93% | 872 | coiled-coil domain-containing protein 135 |
| Canis familiaris | Dog | XP_544386.2 | 85% | 92% | 903 | Predicted: similar to chromosome 16 open reading frame 50 |
| Equus caballus | Horse | XP_001915581 | 81% | 87% | 831 | Predicted: similar to Coiled-coil domain containing 135 |
| Rattus norvegicus | Rat | NP_001099639 | 84% | 91% | 874 | hypothetical protein LOC291853 |
| Mus musculus | Mouse | NP_001036180 | 82% | 90% | 876 | coiled-coil domain containing 135 |
| Ornithorhynchus anatinus | Platypus | XP_001508368.1 | 71% | 85% | 860 | Predicted: similar to Coiled-coil domain containing 135 |
| Monodelphis domestica | Opossum | XP_001363193.1 | 70% | 84% | 866 | Predicted: hypothetical protein isoform 1 |
| Gallus gallus | Chicken | XP_425101.2 | 57% | 72% | 868 | Predicted: hypothetical protein |
| Taeniopygia guttata | Zebra finch | XP_002195392.1 | 50% | 67% | 731 | Predicted: hypothetical protein |
| Xenopus troicalis | Frog | NP_001072331.1 | 56% | 71% | 856 | coiled-coil domain containing 135 |
| Danio rerio | Zebrafish | XP_683491 | 46% | 66% | 721 | Predicted: similar to Coiled-coil domain-containing protein 135 |
| Tetraodon nigroviridis | Tetraodon | CAG07272 | 42% | 59% | 526 | unnamed protein product |
| Nematostella vectensis | Sea anemone | XP_001632291 | 53% | 70% | 817 | predicted protein |
| Branchiostoma floridae | Lancelet | XP_002610594 | 51% | 71% | 850 | hypothetical protein BRAFLDRAFT_275841 |
| Ciona intestinalis | Sea squirt | XP_002123665 | 49% | 69% | 837 | Predicted: similar to coiled-coil domain containing 135 |
| Anopheles gambiae | Mosquito | XP_312247.4 | 32% | 49% | 662 | AGAP002677-PA |
| Nasonia vitripennis | Wasp | XP_001607094 | 34% | 55% | 868 | Predicted: hypothetical protein |
| Drosophila melanogaster | Fruit fly | NP_001036757.1 | 28% | 47% | 897 | CG34110 |
CCDC135 is predicted to be a Cytosol/Nuclear protein [17] with no transmembrane spans or segments. It is predicted to contain at least 56 specific phosphorylation sites [18] which include: 20 Protein Kinase C Phosphorylation sites, 11 Casein Kinase II Phosphorylation sites, and 8 cAMP/cGMP Dependent Phosphorylation sites. The amino acid sequence is also predicted to contain 10 sumoylation [19] sites at positions K236, K236, K45, K773, K499, K679, K249, K167, K540, K445, and K292.
The function of CCDC135 is not yet well understood but it is thought to be involved in teratospermia.[ dubious – discuss ][ citation needed ]
Transmembrane protein 50A is a protein that in humans is encoded by the TMEM50A gene.
Transmembrane protein 8B is a protein that in humans is encoded by the TMEM8B gene. It encodes for a transmembrane protein that is 338 amino acids long, and is located on human chromosome 9. Aliases associated with this gene include C9orf127, NAG-5, and NGX61.
Leucine rich repeat containing 57, also known as LRRC57 is a protein encoded in humans by the LRRC57 gene.
Transmembrane protein 53, or TMEM53, is a protein that is encoded on chromosome 1 in humans. It has no paralogs but is predicted to have many orthologs across eukaryotes.
Coiled coil domain containing 90B, also known as CCDC90B, is a protein encoded by the CCDC90B gene.
Tetratricopeptide repeat 39A is a human protein encoded by the TTC39A gene. TTC39A is also known as DEME-6, KIAA0452, and c1orf34. The function of TTC39A is currently not well understood. The main feature within tetratricopeptide repeat 39A is the domain of unknown function 3808 (DUF3808), spanning almost the entire protein. KIAA0452 can also be seen as an isoform of TTC39A because of differences in genome sequence, but overlap in DUF domain.
TMEM69, also known as Transmembrane protein 69, is a protein that in humans is encoded by the TMEM69 gene. A notable feature of the protein encoded by TMEM69 is the presence of five transmembrane segments.
INAVA, sometimes referred to as hypothetical protein LOC55765, is a protein of unknown function that in humans is encoded by the INAVA gene. Less common gene aliases include FLJ10901 and MGC125608.
Coiled-coil domain-containing protein 144A is a protein that in humans is encoded by the CCDC144A gene. An alias of this gene is called KIAA0565. There are four members of the CCDC family: CCDC 144A, 144B, 144C and putative CCDC 144 N-terminal like proteins.
Coiled Coil Domain Containing protein 42B, also known as CCDC42B, is a protein encoded by the protein-coding gene CCDC42B.
Coiled-coil domain 47 (CCDC47) is a gene located on human chromosome 17, specifically locus 17q23.3 which encodes for the protein CCDC47. The gene has several aliases including GK001 and MSTP041. The protein itself contains coiled-coil domains, the SEEEED superfamily, a domain of unknown function (DUF1682) and a transmembrane domain. The function of the protein is unknown, but it has been proposed that CCDC47 is involved in calcium ion homeostasis and the endoplasmic reticulum overload response.
GPATCH11 is a protein that in humans is encoded by the G-patch domain containing protein 11 gene. The gene has four transcript variants encoding two functional protein isoforms and is expressed in most human tissues. The protein has been found to interact with several other proteins, including two from a splicing pathway. In addition, GPATCH11 has orthologs in all taxa of the eukarya domain.
FAM210B is a gene that which in Homo sapiens encodes the protein FAM210B. It has been conserved throughout evolutionary history, and is highly expressed in multiple tissues within the human body. FAM210B's primary location is the endoplasmic reticulum.
Transmembrane and coiled-coil domains 4, TMCO4, is a protein in humans that is encoded by the TMCO4 gene. Currently, its function is not well defined. It is transmembrane protein that is predicted to cross the endoplasmic reticulum membrane three times. TMCO4 interacts with other proteins known to play a role in cancer development, hinting at a possible role in the disease of cancer.
Transmembrane Protein 217 is a protein encoded by the gene TMEM217. TMEM217 has been found to have expression correlated with the lymphatic system and endothelial tissues and has been predicted to have a function linked to the cytoskeleton.
Golgin subfamily A member 8H, also known as GOLGA8H, is a protein that in Homo sapiens is encoded by the GOLGA8H gene. Function of the GOLGA8H involves a process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of the Golgi apparatus.
C16orf90 or chromosome 16 open reading frame 90 produces uncharacterized protein C16orf90 in homo sapiens. C16orf90's protein has four predicted alpha-helix domains and is mildly expressed in the testes and lowly expressed throughout the body. While the function of C16orf90 is not yet well understood by the scientific community, it has suspected involvement in the biological stress response and apoptosis based on expression data from microarrays and post-translational modification data.
C12orf24 is a gene in humans that encodes a protein known as FAM216A. This gene is primarily expressed in the testis and brain, but has constitutive expression in 25 other tissues. FAM216A is an intracellular protein that has been predicted to reside within the nucleus of cells. The exact function of C12orf24 is unknown. FAM216A is highly expressed in Sertoli cells of the testis as well as different stage spermatids.
Transmembrane protein 104 (TMEM104) is a protein that in humans is encoded by the TMEM104 gene. The aliases of TMEM104 are FLJ00021 and FLJ20255. Humans have a 163,255 base pair long gene coding sequence, 4703 base pair long mRNA, and 496 amino acid long protein sequence. In Eukaryotes, the TMEM104 gene is conserved.
Transmembrane protein 19 is a protein that in humans is encoded by the TMEM19 gene.
