The alternative flatworm mitochondrial code (translation table 14) is a genetic code found in the mitochondria of Platyhelminthes and Nematodes.
AAs = FFLLSSSSYYY*CCWWLLLLPPPPHHQQRRRRIIIMTTTTNNNKSSSSVVVVAAAADDEEGGGG Starts = -----------------------------------M---------------------------- Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGBases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).
Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V)
| DNA codons | RNA codons | This code (14) | Standard code (1) | |
|---|---|---|---|---|
AAA | AAA | Asn(N) | Lys(K) | |
AGA | AGA | Ser(S) | Arg(R) | |
AGG | AGG | Ser(S) | Arg(R) | |
TAA | UAA | Tyr(Y) | STOP = Ter(*) | |
TGA | UGA | Trp(W) | STOP = Ter(*) |
Code 14 differs from code 9 (the echinoderm and flatworm mitochondrial code) only by translating UAA to Tyr rather than STOP. A study in 2000 [1] has found no evidence that the codon UAA codes for Tyr in the flatworms but other opinions exist. There are very few GenBank records that are translated with code 14 but a test translation shows that re-translating these records with code 9 can cause premature terminations. More recently, UAA has been found to code for tyrosine in the nematodes Radopholus similis [2] and Radopholus arabocoffeae . [3]
Radopholus similis is a species of nematode known commonly as the burrowing nematode. It is a parasite of plants, and it is a pest of many agricultural crops. It is an especially important pest of bananas, and it can be found on coconut, avocado, coffee, sugarcane, other grasses, and ornamentals. It is a migratory endoparasite of roots, causing lesions that form cankers. Infected plants experience malnutrition.
The pterobranchia mitochondrial code is a genetic code used by the mitochondrial genome of Rhabdopleura compacta (Pterobranchia). The Pterobranchia are one of the two groups in the Hemichordata which together with the Echinodermata and Chordata form the three major lineages of deuterostomes. AUA translates to isoleucine in Rhabdopleura as it does in the Echinodermata and Enteropneusta while AUA encodes methionine in the Chordata. The assignment of AGG to lysine is not found elsewhere in deuterostome mitochondria but it occurs in some taxa of Arthropoda. This code shares with many other mitochondrial codes the reassignment of the UGA STOP to tryptophan, and AGG and AGA to an amino acid other than arginine. The initiation codons in Rhabdopleura compacta are ATG and GTG.
The yeast mitochondrial code is a genetic code used by the mitochondrial genome of yeasts, notably Saccharomyces cerevisiae, Candida glabrata, Hansenula saturnus, and Kluyveromyces thermotolerans.
The mold, protozoan, and coelenterate mitochondrial code and the mycoplasma/spiroplasma code is the genetic code used by various organisms, in some cases with slight variations, notably the use of UGA as a tryptophan codon rather than a stop codon.
The invertebrate mitochondrial code is a genetic code used by the mitochondrial genome of invertebrates. Mitochondria contain their own DNA and reproduce independently from their host cell. Variation in translation of the mitochondrial genetic code occurs when DNA codons result in non-standard amino acids has been identified in invertebrates, most notably arthropods. This variation has been helpful as a tool to improve upon the phylogenetic tree of invertebrates, like flatworms.
The ciliate, dasycladacean and Hexamita nuclear code is a genetic code used by certain ciliate, dasycladacean and Hexamita species.
The echinoderm and flatworm mitochondrial code is a genetic code used by the mitochondria of certain echinoderm and flatworm species.
The alternative yeast nuclear code is a genetic code found in certain yeasts. However, other yeast, including Saccharomyces cerevisiae, Candida azyma, Candida diversa, Candida magnoliae, Candida rugopelliculosa, Yarrowia lipolytica, and Zygoascus hellenicus, definitely use the standard (nuclear) code.
The ascidian mitochondrial code is a genetic code found in the mitochondria of Ascidia.
Radopholus arabocoffeae is a nematode in the genus Radopholus. It is notable as an early example, along with Radopholus similis, of the alternative flatworm mitochondrial code.
The Blepharisma nuclear code is a genetic code found in the nuclei of Blepharisma.
The chlorophycean mitochondrial code is a genetic code found in the mitochondria of Chlorophyceae.
The trematode mitochondrial code is a genetic code found in the mitochondria of Trematoda.
The Scenedesmus obliquusmitochondrial code is a genetic code found in the mitochondria of Scenedesmus obliquus, a species of green algae.
The Thraustochytrium mitochondrial code is a genetic code found in the mitochondria of the labyrinthulid protist Thraustochytrium aureum. The mitochondrial genome was sequenced by the Organelle Genome Megasequencing Program.
The pachysolen tannophilus nuclear code is a genetic code found in the ascomycete fungus Pachysolen tannophilus.
The karyorelictid nuclear code is a genetic code used by the nuclear genome of the Karyorelictea ciliate Parduczia sp. This code, along with translation tables 28 and 31, is remarkable in that every one of the 64 possible codons can be a sense codon. Translation termination probably relies on context, specifically proximity to the poly(A) tail.
The Mesodinium nuclear code is a genetic code used by the nuclear genome of the ciliates Mesodinium and Myrionecta.
The peritrich nuclear code is a genetic code used by the nuclear genome of the peritrich ciliates Vorticella and Opisthonecta.
The Cephalodiscidae mitochondrial code is a genetic code used by the mitochondrial genome of Cephalodiscidae (Pterobranchia). The Pterobranchia are one of the two groups in the Hemichordata which together with the Echinodermata and Chordata form the major clades of deuterostomes.
This article incorporates text from the United States National Library of Medicine, which is in the public domain. [4]