Enteroglucagon

Last updated

Enteroglucagon is a peptide hormone derived from preproglucagon. It is a gastrointestinal hormone, secreted from mucosal cells primarily of the colon and terminal ileum. [1] It consists of 37 amino acids. Enteroglucagon is released when fats and glucose are present in the small intestine; which decrease the motility to allow sufficient time for these nutrients to be absorbed.

Contents

Discovery

In 1948, Sutherland and De Duve identified a gastrointestinal glucagon-like material in gastric mucosa, [2] the term "enteroglucagon" was used to describe this material that shared a similar immunoreactivity with glucagon. [3] A half-century later, Brubaker and Drucker [4] studied proglucagon gene expression, they discovered the function of enteroglucagon is related to the growth of intestinal epithelium. [5]

Function

Enteroglucagon is a proglucagon-derived peptide or enteroendocrine cells derived peptide in the small intestine. Preproglucagon undergoes post translational modification to release glucagon-like peptides (GLP-1 and GLP-2) and other molecules derived from L-cells of intestine. GLP-1 is derived from a class of intestinal hormones called incretin and the molecule exists in two forms GLP-1(7-37) and GLP-1(7-36) amide. [6] GLP-1 form of incretin starts circulating in response to a high blood glucose level. Incretin effect is a negative feedback loop between glucose and insulin level, it promotes insulin release from beta cells of pancreas islet and suppresses glucagon when the glucose level is high. [7] In vertebrate mammals, GLP-2 sequences are highly conversed in the intestine. [2] The molecule functions as a part of adaptive response, such that contributes intestinal growth, proliferation effect, intestinal dilation (increases the mucosal blood flow) and reduces the chance of apoptosis. [2]

Clinical significance

GLP-1 is effective at reducing blood glucose levels. GLP-1 analogs have a significant therapeutic effect and high efficacy on diabetes treatments and hypoglycemia prevention. [8] Proliferation effect and trophic effect on the small intestine, GLP-2 is used as a therapy to support patients with short-bowel syndrome and other underlying intestinal conditions. [9]

See also

Related Research Articles

<span class="mw-page-title-main">Incretin</span> Group of gastrointestinal hormones

Incretins are a group of metabolic hormones that stimulate a decrease in blood glucose levels. Incretins are released after eating and augment the secretion of insulin released from pancreatic beta cells of the islets of Langerhans by a blood-glucose–dependent mechanism.

<span class="mw-page-title-main">Glucose-dependent insulinotropic polypeptide</span> Mammalian protein found in Homo sapiens

Glucose-dependent insulinotropic polypeptide, abbreviated as GIP, is an inhibiting hormone of the secretin family of hormones. While it is a weak inhibitor of gastric acid secretion, its main role, being an incretin, is to stimulate insulin secretion.

Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion.

<span class="mw-page-title-main">Vildagliptin</span> Chemical compound

Vildagliptin, sold under the brand name Galvus and others, is an oral anti-hyperglycemic agent of the dipeptidyl peptidase-4 (DPP-4) inhibitor class of drugs. Vildagliptin inhibits the inactivation of GLP-1 and GIP by DPP-4, allowing GLP-1 and GIP to potentiate the secretion of insulin in the beta cells and suppress glucagon release by the alpha cells of the islets of Langerhans in the pancreas.

<span class="mw-page-title-main">Dipeptidyl peptidase-4 inhibitor</span> Enzyme blocker and diabetes treatment drug

Inhibitors of dipeptidyl peptidase 4 are a class of oral hypoglycemics that block the enzyme dipeptidyl peptidase-4 (DPP-4). They can be used to treat diabetes mellitus type 2.

<span class="mw-page-title-main">Proglucagon</span>

Proglucagon is a protein that is cleaved from preproglucagon. Preproglucagon in humans is encoded by the GCG gene.

<span class="mw-page-title-main">Glucagon-like peptide-1</span> Gastrointestinal peptide hormone Involved in glucose homeostasis

Glucagon-like peptide-1 (GLP-1) is a 30- or 31-amino-acid-long peptide hormone deriving from the tissue-specific posttranslational processing of the proglucagon peptide. It is produced and secreted by intestinal enteroendocrine L-cells and certain neurons within the nucleus of the solitary tract in the brainstem upon food consumption. The initial product GLP-1 (1–37) is susceptible to amidation and proteolytic cleavage, which gives rise to the two truncated and equipotent biologically active forms, GLP-1 (7–36) amide and GLP-1 (7–37). Active GLP-1 protein secondary structure includes two α-helices from amino acid position 13–20 and 24–35 separated by a linker region.

<span class="mw-page-title-main">Enteroendocrine cell</span> Cell that produces gastrointestinal hormones

Enteroendocrine cells are specialized cells of the gastrointestinal tract and pancreas with endocrine function. They produce gastrointestinal hormones or peptides in response to various stimuli and release them into the bloodstream for systemic effect, diffuse them as local messengers, or transmit them to the enteric nervous system to activate nervous responses. Enteroendocrine cells of the intestine are the most numerous endocrine cells of the body. They constitute an enteric endocrine system as a subset of the endocrine system just as the enteric nervous system is a subset of the nervous system. In a sense they are known to act as chemoreceptors, initiating digestive actions and detecting harmful substances and initiating protective responses. Enteroendocrine cells are located in the stomach, in the intestine and in the pancreas. Microbiota play key roles in the intestinal immune and metabolic responses in these enteroendocrine cells via their fermentation product, acetate.

<span class="mw-page-title-main">Glucagon-like peptide-1 receptor</span> Receptor activated by peptide hormone GLP-1

The glucagon-like peptide-1 receptor (GLP1R) is a G protein-coupled receptor (GPCR) found on beta cells of the pancreas and on neurons of the brain. It is involved in the control of blood sugar level by enhancing insulin secretion. In humans it is synthesised by the gene GLP1R, which is present on chromosome 6. It is a member of the glucagon receptor family of GPCRs. GLP1R is composed of two domains, one extracellular (ECD) that binds the C-terminal helix of GLP-1, and one transmembrane (TMD) domain that binds the N-terminal region of GLP-1. In the TMD domain there is a fulcrum of polar residues that regulates the biased signaling of the receptor while the transmembrane helical boundaries and extracellular surface are a trigger for biased agonism.

<span class="mw-page-title-main">Peptide PHI</span>

Peptide PHI, also known as peptide histidine isoleucine, is a peptide which functions as a hormone. This peptide contains a composition of 27 amino acids with histidine on the N-terminus and isoleucine on the C-terminus. It was originally isolated from the mammalian small intestine amongst mammalian neurons called intramural neurons which function in the motor activity of the intestinal walls. An example of this was revealed in a study that demonstrated that this peptide regulates water and electrolyte transportation in the human jejunum; similar to its inhibitory effects on fluid absorption in the small intestine of pigs and rats.

<span class="mw-page-title-main">Gastric inhibitory polypeptide receptor</span> Protein-coding gene in the species Homo sapiens

Structures of GIPR human variant Sun, B., Kobilka, B.K., Sloop, K.W., Feng, D., Kobilka, T.S.

<span class="mw-page-title-main">Glucagon-like peptide-2 receptor</span> Protein-coding gene in the species Homo sapiens

Glucagon-like peptide-2 receptor (GLP-2R) is a protein that in human is encoded by the GLP2R gene located on chromosome 17.

The glucagon receptor family is a group of closely related G-protein coupled receptors which include:

Rose Pharma is a private company that was founded in 2003 as Gastrotech Pharma and is located in Copenhagen, Denmark. The company is led by CEO Leif Helth Jensen, who is, together with Michael Forer and Florian Schönharting, also member of the Board of Directors. Rose Pharma is a clinical stage biotechnology company focused on the development of novel treatments for IBS and anorexia/cachexia associated with cancer and other major pathologies.

Glucagon-like peptide-1 (GLP-1) receptor agonists, also known as GLP-1 analogs, GLP-1DAs or incretin mimetics, are a class of drugs that reduce blood sugar and energy intake by activating the GLP-1 receptor. They mimic the actions of the endogenous incretin hormone GLP-1 that is released by the gut after eating.

<span class="mw-page-title-main">Gemigliptin</span> Chemical compound

Gemigliptin (rINN), sold under the brand name Zemiglo, is an oral anti-hyperglycemic agent of the dipeptidyl peptidase-4 inhibitor class of drugs. Glucose lowering effects of DPP-4 inhibitors are mainly mediated by GLP-1 and gastric inhibitory polypeptide (GIP) incretin hormones which are inactivated by DPP-4.

<span class="mw-page-title-main">Daniel J. Drucker</span> Canadian endocrinologist (born 1956)

Daniel Joshua Drucker is a Canadian endocrinologist. A Fellow of the Royal Society, he is a professor of medicine at the Lunenfeld-Tanenbaum Research Institute, Mount Sinai Hospital, Toronto. He is known for his research into intestinal hormones and their use in the treatment of diabetes, obesity, and other metabolic diseases, as well as intestinal failure.

<span class="mw-page-title-main">Omarigliptin</span> Chemical compound

Omarigliptin (MK-3102) is a potent, long-acting oral antidiabetic drug of the DPP-4 inhibitor class used for once-weekly treatment of type 2 diabetes and currently under development by Merck & Co. It inhibits DPP-4 to increase incretin levels, which inhibit glucagon release, which in turn increases insulin secretion, decreases gastric emptying and decreases blood glucose levels.

Svetlana Mojsov is a Yugoslavian-born chemist who is a research associate professor at Rockefeller University. Her research considers peptide synthesis. She discovered the glucagon-like peptide-1 and uncovered its role in glucose metabolism and the secretion of insulin. Her breakthroughs were transformed by Novo Nordisk into therapeutic agents against diabetes and obesity.

GLP1 poly-agonist peptides are a class of drugs that activate multiple peptide hormone receptors including the glucagon-like peptide-1 (GLP-1) receptor. These drugs are developed for the same indications as GLP-1 receptor agonists—especially obesity, type 2 diabetes, and non-alcoholic fatty liver disease. They are expected to provide superior efficacy with fewer adverse effects compared to GLP-1 mono-agonists, which are dose-limited by gastrointestinal disturbances. The effectiveness of multi-receptor agonists could possibly equal or exceed that of bariatric surgery. The first such drug to receive approval is tirzepatide, a dual agonist of GLP-1 and GIP receptors.

References

  1. ↑ Holst, J. J. (1997). "Enteroglucagon". Annual Review of Physiology. 59: 257–71. doi:10.1146/annurev.physiol.59.1.257. PMID   9074764.
  2. 1 2 3 Dunphy, J. L.; Fuller, P. J. (1997-09-19). "Enteroglucagon, bowel growth and GLP-2". Molecular and Cellular Endocrinology. 132 (1–2): 7–11. doi:10.1016/s0303-7207(97)00137-8. ISSN   0303-7207. PMID   9324041. S2CID   8182049.
  3. ↑ Sarwal, Dhruv; Bordoni, Bruno (2021), "Physiology, Enteroglucagon", StatPearls, Treasure Island (FL): StatPearls Publishing, PMID   31971745 , retrieved 2021-05-02
  4. ↑ Drucker, Daniel J.; Shi, Qing; Crivici, Anna; Sumner-Smith, Martin; Tavares, Wendy; Hill, Mary; DeForest, Lorraine; Cooper, Sari; Brubaker, Patricia L. (July 1997). "Regulation of the biological activity of glucagon-like peptide 2 in vivo by dipeptidyl peptidase IV". Nature Biotechnology. 15 (7): 673–677. doi:10.1038/nbt0797-673. ISSN   1546-1696. PMID   9219272. S2CID   35172107.
  5. ↑ Drucker, D J; Erlich, P; Asa, S L; Brubaker, P L (1996-07-23). "Induction of intestinal epithelial proliferation by glucagon-like peptide 2". Proceedings of the National Academy of Sciences of the United States of America. 93 (15): 7911–7916. Bibcode:1996PNAS...93.7911D. doi: 10.1073/pnas.93.15.7911 . ISSN   0027-8424. PMC   38848 . PMID   8755576.
  6. ↑ Deacon, Carolyn F. (September 2007). "Incretin-based treatment of type 2 diabetes: glucagon-like peptide-1 receptor agonists and dipeptidyl peptidase-4 inhibitors". Diabetes, Obesity & Metabolism. 9 (Suppl 1): 23–31. doi:10.1111/j.1463-1326.2007.00765.x. ISSN   1462-8902. PMID   17877544. S2CID   12334916.
  7. ↑ Sarwal, Dhruv; Bordoni, Bruno (2021), "Physiology, Enteroglucagon", StatPearls, Treasure Island (FL): StatPearls Publishing, PMID   31971745 , retrieved 2021-04-30
  8. ↑ Trujillo, Jennifer M.; Nuffer, Wesley; Ellis, Samuel L. (February 2015). "GLP-1 receptor agonists: a review of head-to-head clinical studies". Therapeutic Advances in Endocrinology and Metabolism. 6 (1): 19–28. doi:10.1177/2042018814559725. ISSN   2042-0188. PMC   4321870 . PMID   25678953.
  9. ↑ Jeppesen, P. B. (November 2003). "Clinical significance of GLP-2 in short-bowel syndrome". The Journal of Nutrition. 133 (11): 3721–3724. doi: 10.1093/jn/133.11.3721 . ISSN   0022-3166. PMID   14608103.
This page is based on this Wikipedia article
Text is available under the CC BY-SA 4.0 license; additional terms may apply.
Images, videos and audio are available under their respective licenses.