Acetolactate synthase

Last updated

acetolactate synthase
Acetolactase Synthase.png
Crystal structure of Arabidopsis thaliana acetohydroxyacid synthase complexed with a sulfonylurea herbicide, metsulfuron-methyl. [1]
Identifiers
EC no. 2.2.1.6
CAS no. 9027-45-6
Alt. namespyruvate:pyruvate acetaldehydetransferase (decarboxylating)
Databases
IntEnz IntEnz view
BRENDA BRENDA entry
ExPASy NiceZyme view
KEGG KEGG entry
MetaCyc metabolic pathway
PRIAM profile
PDB structures RCSB PDB PDBe PDBsum
Gene Ontology AmiGO / QuickGO
Search
PMC articles
PubMed articles
NCBI proteins

The acetolactate synthase (ALS) enzyme (also known as acetohydroxy acid or acetohydroxyacid synthase, abbr. AHAS) [2] is a protein found in plants and micro-organisms. ALS catalyzes the first step in the synthesis of the branched-chain amino acids (valine, leucine, and isoleucine). [3]

Contents

A human protein of yet unknown function, sharing some sequence similarity with bacterial ALS, is encoded by the ILVBL (ilvB-like) gene. [4]

Structure

Gene

Human ILVBL gene has 17 exons resides on chromosome 19 at q13.1. [5]

Protein

The catalytic peptide of ALS in Arabidopsis thaliana (mouse-eared cress) is a chloroplastic protein consisting of 670 residues, the last 615 of which form the active form. Three main domains are found, with two thiamine pyrophosphate sandwiching a DHS-like NAD/FAD-binding domain. [6] In SCOP assignment, these subunits are named d1yhya1, d1yhya2, and d1yhya3 from the N-terminal to the C-termianl. [7]

The structure of acetolactate synthase that was used for the picture on this page was determined using X-ray diffraction at 2.70 angstroms. X-ray diffraction uses X-rays at specified wavelengths to produce patterns, as the X–ray is scattered in certain ways that give an idea to the structure of the molecule being analyzed.

There are five specific ligands that interact with this protein. The five are listed below.

Ligand IdentifierNameStructure
P22ETHYL DIHYDROGEN DIPHOSPHATEC2H8O7P2
NHE2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACIDC8H17NO3S
MgMagnesium IonMg
FADFLAVIN-ADENINE DINUCLEOTIDEC27H33N9O15P2
1SMMETHYL 2-[({[(4,6-DIMETHYLPYRIMIDIN-2-YL)AMINO]CARBONYL}AMINO)SULFONYL]BENZOATEC15H16N4O5 S

The FAD bound is not catalytic.

Function

Acetolactate synthase is catalytic enzyme involved in the biosynthesis of various amino acids. This enzyme has the Enzyme Commission Code is 2.2.1.6, which means that the enzyme is a transketolase or a transaldolase, which is classified under the transferases that transfer aldehyde or ketone residues. In this case, acetolactate synthase is a transketolase, which moves back and forth, having both catabolic and anabolic forms. These act on a ketone (pyruvate) and can go back and forth in the metabolic chain. These are found in humans, animals, plants, and bacteria. In plants, they are located in the chloroplasts in order to help with the metabolic processes. [6] In baker's yeast, they are located in the mitochondria. [8] In several experiments, it has been shown that mutated strains of Escherichia coli K-12 without the enzyme were not able to grow in the presence of only acetate or oleate as the only carbon sources. [9]

A catabolic version that does not bind FAD (InterPro :  IPR012782 ) is found in some bacteria.

Catalytic activity

Acetolactate synthase, also known as acetohydroxy acid synthase, is an enzyme specifically involved in the conversion of pyruvate to acetolactate:

2 CH3COCO2− → −O2CC(OH)(CH3)COCH3 + CO2

The reaction uses thiamine pyrophosphate in order to link the two pyruvate molecules. The resulting product of this reaction, acetolactate, eventually becomes valine, leucine, and isoleucine. All three of these amino acids are essential amino acids and cannot be synthesized by humans. This also leads to the systemic name pyruvate:pyruvate acetaldehydetransferase (decarboxylating). This enzyme is the first of several enzymes in the biosynthesis cycle for leucine and valine, taking the initial pyruvate molecules and starting the conversion from pyruvic acid to the amino acids. The specific residue that is responsible for this is a glycine at position 511 in the protein. This is the one that requires a cofactor of TPP for its function.

Four specific residues are responsible for catalytic activity in this enzyme. They are listed here with cofactors required written after.

ResiduePositionCofactors
Valine485HE3
Methionine513HE3
Histidine643-
Glycine511TPP

The primary sequence of this protein in Arabidopsis is listed below. Residues involved in catalytic activity are bolded. Mutagenesis of Asp428, which is crucial carboxylate ligand to Mg(2+) in the "ThDP motif", leads to a decrease in the affinity of AHAS II for Mg(2+). While mutant D428N shows ThDP affinity close to that of the wild-type on saturation with Mg(2+), D428E has a decreased affinity for ThDP. These mutations also lead to dependence of the enzyme on K(+). [10]

Primary sequence. [11] Catalytic residues are bold
>sp|P1759|86-667 TFISRFAPDQPRKGADILVEALERQGVETVFAYPGGASMEIHQALTRSSSIRNVLPRHEQGGVFAAEGYARSSGKPGICIATSGPGATNLVSGLADALLD SVPLVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYLVMDVEDIPRIIEEAFFLATSGRPGPVLVDVPKDIQQQLAIPNWEQAMRLPGYMSRMPKPPE DSHLEQIVRLISESKKPVLYVGGGCLNSSDELGRFVELTGIPVASTLMGLGSYPXDDELSLHMLGMHGTVYANYAVEHSDLLLAFGVRFDDRVTGKLEAF ASRAKIVHIDIDSAEIGKNKTPHVSVCGDVKLALQGMNKVLENRAEELKLDFGVWRNELNVQKQKFPLSFKTFGEAIPPQYAIKVLDELTDGKAIISTGV GQHQMWAAQFYNYKKPRQWLSSGGLGAMGFGLPAAIGASVANPDAIVVDIDGDGSFIMNVQELATIRVENLPVKVLLLNNQHLGMVMQWEDRFYKANRAH TFLGDPAQEDEIFPNMLLFAAACGIPAARVTKKADLREAIQTMLDTPGPYLLDVICPHQEHVLPMIPSGGTFNDVITEGDGR

Because of inhibition and several factors it is a slow procedure.

Regulation

In Arabidopsis, two chains of catalytic ALS (InterPro :  IPR012846 ) is complexed with two regulatory small subunits (InterPro :  IPR004789 ), AHASS2 and AHASS1 [12] [13] [14] . Such an arrangement is widespread in both bacterial and eukaryotic ALS. The hetromeric structure was demonstrated in E. coli in 1984 and in eukaryotes (S. cerevisiae and Porphyra purpurea) in 1997. [15] Most of the regulatory proteins have an ACT domain (InterPro :  IPR002912 ) and some of them have a NiKR-like C-terminal (InterPro :  IPR027271 )

In bacteria (E. coli)), Acetolactate synthase consists of three pairs of isoforms. Each pair includes a large subunit, which is thought to be responsible for catalysis, and a small subunit for feedback inhibition. Each subunit pair, or ALS I, II, and III respectively, is located on its own operon, ilvBN, ilvGM and ilvIH (where ilvN regulated ilvB, and vice versa). Together, these operons code for several enzymes involved in branched-chain amino acid biosynthesis. Regulation is different for each operon. [16]

The ilvGMEDA operon encodes the ilvGM (ALS II) pair as well as a branched-chain-amino-acid transaminase (ilvE), dihydroxy-acid dehydratase (ilvD), and threonine ammonia-lyase (ilvA). It is regulated by feedback inhibition in the form of transcriptional attenuation. That is, transcription is reduced in the presence of the pathway's end-products, the branched-chain amino acids.

The ilvBNC operon encodes the ilvBN (ALS I) pair and a ketol-acid reductoisomerase (ilvC). It is similarly regulated, but is specific to isoleucine and leucine; valine does not affect it directly.

Both the ilvGMEDA and ilvBNC operons are derepressed during shortages of the branched-chain amino acids by the same mechanism that represses them. Both of these operons as well as the third, ilvIH, are regulated by leucine-responsive protein (Lrp). [17] [18]

Inhibitors

Inhibitors of ALS are used as herbicides that slowly starve affected plants of these amino acids, which eventually leads to inhibition of DNA synthesis. They affect grasses and dicots alike. They are not a chemistry class but rather a mechanism of action class with diverse chemistries. The ALS inhibitor family includes sulfonylureas (SUs), imidazolinones, triazolopyrimidines (see Category:Triazolopyrimidines), pyrimidinyl oxybenzoates, and sulfonylamino carbonyl triazolinones. [19] As of March 2022, the ALS inhibitors suffer the worst (known) resistance problem of all herbicide classes, having 169 known resistant target species. [20] The structures of ALS herbicides are radically different from the normal substrate and so none of them bind at the catalytic site but instead at a site specific to herbicidal action. Therefore resistance mutations are expected to have widely varying effects on normal ALS catalysis activity, positive, negative and neutral. Unsurprisingly that is exactly what experiments have shown, including Yu et al., 2007 finding resistance in Hordeum murinum due to a proline→serine substitution at amino acid 197 to increase ALS activity by 2x-3x. [2]

Clinical significance

CADASIL, an identified autosomal dominant condition characterized by the recurrence of subcortical infarcts leading to dementia, was previously mapped to “ILVBL” gene within a 2-cM interval, D19S226–D19S199. This gene encodes a protein highly similar to the acetolactate synthase of other organisms. No recombination event was observed with D19S841, a highly polymorphic microsatellite marker isolated from a cosmid mapped to this region. No mutation was detected on this gene in CADASIL patients, suggesting that it is not implicated in this disorder. [4]

Interactions

In the study of Escherichia coli, the FAD binding domain of ilvB has been shown to interact with ilvN and activate the AHAS I enzyme. [21]

Related Research Articles

<span class="mw-page-title-main">Isoleucine</span> Chemical compound

Isoleucine (symbol Ile or I) is an α-amino acid that is used in the biosynthesis of proteins. It contains an α-amino group (which is in the protonated −NH+3 form under biological conditions), an α-carboxylic acid group (which is in the deprotonated −COO− form under biological conditions), and a hydrocarbon side chain with a branch (a central carbon atom bound to three other carbon atoms). It is classified as a non-polar, uncharged (at physiological pH), branched-chain, aliphatic amino acid. It is essential in humans, meaning the body cannot synthesize it. Essential amino acids are necessary in the human diet. In plants isoleucine can be synthesized from threonine and methionine. In plants and bacteria, isoleucine is synthesized from pyruvate employing leucine biosynthesis enzymes. It is encoded by the codons AUU, AUC, and AUA.

<span class="mw-page-title-main">Aspartate carbamoyltransferase</span> Protein family

Aspartate carbamoyltransferase catalyzes the first step in the pyrimidine biosynthetic pathway.

<span class="mw-page-title-main">Branched-chain amino acid</span> Amino acid with a branched carbon chain

A branched-chain amino acid (BCAA) is an amino acid having an aliphatic side-chain with a branch. Among the proteinogenic amino acids, there are three BCAAs: leucine, isoleucine, and valine. Non-proteinogenic BCAAs include 2-aminoisobutyric acid and alloisoleucine.

The branched-chain α-ketoacid dehydrogenase complex is a multi-subunit complex of enzymes that is found on the mitochondrial inner membrane. This enzyme complex catalyzes the oxidative decarboxylation of branched, short-chain alpha-ketoacids. BCKDC is a member of the mitochondrial α-ketoacid dehydrogenase complex family, which also includes pyruvate dehydrogenase and alpha-ketoglutarate dehydrogenase, key enzymes that function in the Krebs cycle.

<span class="mw-page-title-main">Amino acid synthesis</span> The set of biochemical processes by which amino acids are produced

Amino acid biosynthesis is the set of biochemical processes by which the amino acids are produced. The substrates for these processes are various compounds in the organism's diet or growth media. Not all organisms are able to synthesize all amino acids. For example, humans can synthesize 11 of the 20 standard amino acids. These 11 are called the non-essential amino acids.

Propionyl-CoA is a coenzyme A derivative of propionic acid. It is composed of a 24 total carbon chain and its production and metabolic fate depend on which organism it is present in. Several different pathways can lead to its production, such as through the catabolism of specific amino acids or the oxidation of odd-chain fatty acids. It later can be broken down by propionyl-CoA carboxylase or through the methylcitrate cycle. In different organisms, however, propionyl-CoA can be sequestered into controlled regions, to alleviate its potential toxicity through accumulation. Genetic deficiencies regarding the production and breakdown of propionyl-CoA also have great clinical and human significance.

<span class="mw-page-title-main">Pyruvate dehydrogenase</span> Class of enzymes

Pyruvate dehydrogenase is an enzyme that catalyzes the reaction of pyruvate and a lipoamide to give the acetylated dihydrolipoamide and carbon dioxide. The conversion requires the coenzyme thiamine pyrophosphate.

<span class="mw-page-title-main">Branched-chain amino acid aminotransferase</span> Aminotransferase enzyme

Branched-chain amino acid aminotransferase (BCAT), also known as branched-chain amino acid transaminase, is an aminotransferase enzyme (EC 2.6.1.42) which acts upon branched-chain amino acids (BCAAs). It is encoded by the BCAT2 gene in humans. The BCAT enzyme catalyzes the conversion of BCAAs and α-ketoglutarate into branched chain α-keto acids and glutamate.

<span class="mw-page-title-main">Phosphoribosylanthranilate isomerase</span> Enzyme involved in tryptophan synthesis

In enzymology, a phosphoribosylanthranilate isomerase (PRAI) is an enzyme that catalyzes the third step of the synthesis of the amino acid tryptophan.

<span class="mw-page-title-main">Cystathionine beta-lyase</span> Enzyme

Cystathionine beta-lyase, also commonly referred to as CBL or β-cystathionase, is an enzyme that primarily catalyzes the following α,β-elimination reaction

<span class="mw-page-title-main">Lipoyl synthase</span>

Lipoyl synthase is an enzyme that belongs to the radical SAM (S-adenosyl methionine) family. Within the radical SAM superfamily, lipoyl synthase is in a sub-family of enzymes that catalyze sulfur insertion reactions. The enzymes in this subfamily differ from general radical SAM enzymes, as they contain two 4Fe-4S clusters. From these clusters, the enzymes obtain the sulfur groups that will be transferred onto the corresponding substrates. This particular enzyme participates in the final step of lipoic acid metabolism, transferring two sulfur atoms from its 4Fe-4S cluster onto the protein N6-(octanoyl)lysine through radical generation. This enzyme is usually localized to the mitochondria. Two organisms that have been extensively studied with regards to this enzyme are Escherichia coli and Mycobacterium tuberculosis. It is currently being studied in other organisms including yeast, plants, and humans.

<span class="mw-page-title-main">Anthranilate synthase</span>

The enzyme anthranilate synthase catalyzes the chemical reaction

<span class="mw-page-title-main">Oxalyl-CoA decarboxylase</span>

The enzyme oxalyl-CoA decarboxylase (OXC) (EC 4.1.1.8), primarily produced by the gastrointestinal bacterium Oxalobacter formigenes, catalyzes the chemical reaction

<span class="mw-page-title-main">Malate synthase</span> Class of enzymes

In enzymology, a malate synthase (EC 2.3.3.9) is an enzyme that catalyzes the chemical reaction

2-Succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase, also known as SHCHC synthase is encoded by the menH gene in Escherichia coli and functions in the synthesis of vitamin K. The specific step in the synthetic pathway that SHCHC synthase catalyzes is the conversion of 5-enolpyruvoyl-6-hydroxy-2-succinylcyclohex-3-ene-1-carboxylate to (1R,6R)-6-hydroxy-2-succinylcyclohexa-2,4-diene-1-carboxylate and pyruvate.

<span class="mw-page-title-main">BCKDHA</span> Protein-coding gene in the species Homo sapiens

A 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial is an enzyme that in humans is encoded by the BCKDHA gene.

<span class="mw-page-title-main">Leucine-responsive regulatory protein</span>

Leucine responsive protein, or Lrp, is a global regulator protein, meaning that it regulates the biosynthesis of leucine, as well as the other branched-chain amino acids, valine and isoleucine. In bacteria, it is encoded by the lrp gene.

<span class="mw-page-title-main">Sulfometuron methyl</span> Chemical compound

Sulfometuron methyl is an organic compound used as a herbicide. It is classed as a sulfonylurea. It functions via the inhibitition of acetolactate synthase enzyme, which catalyses the first step in biosynthesis of the branched-chain amino acids valine, leucine and isoleucine.

Harold Edwin Umbarger was an American bacteriologist and biochemist.

specific transmembrane protein complexes called Branched Chain Amino Acid Exporters (LIV-E) mediate the export of branched chain amino acids out of prokaryotic cells. Branched chain amino acids (BCAAs) — isoleucine, leucine, and valine — are critical nutrients in bacterial physiology with roles in protein synthesis and signaling. Regulating the cytosolic level of BCAAs is necessary for cell growth and adaptation. LIV-E transporters are categorized as electrochemical potential-driven transporters, subcategory porters (2.A.78) in the Transporter Classification Database. LIV-E transporters are antiporters that use the proton motive force, catalyzing the transport of two hydrogen ions inside the cell, to obtain the energy to export one amino acid out of the cell.

References

  1. ↑ PDB: 1YHY ​; McCourt JA, Pang SS, King-Scott J, Guddat LW, Duggleby RG (January 2006). "Herbicide-binding sites revealed in the structure of plant acetohydroxyacid synthase". Proceedings of the National Academy of Sciences of the United States of America. 103 (3): 569–73. Bibcode:2006PNAS..103..569M. doi: 10.1073/pnas.0508701103 . PMC   1334660 . PMID   16407096.
  2. 1 2 Powles SB, Yu Q (2010-06-02). "Evolution in action: plants resistant to herbicides". Annual Review of Plant Biology. 61 (1). Annual Reviews: 317–47. doi:10.1146/annurev-arplant-042809-112119. PMID   20192743.
  3. ↑ Chipman D, Barak Z, Schloss JV (June 1998). "Biosynthesis of 2-aceto-2-hydroxy acids: acetolactate synthases and acetohydroxyacid synthases". Biochimica et Biophysica Acta (BBA) - Protein Structure and Molecular Enzymology. 1385 (2): 401–19. doi:10.1016/S0167-4838(98)00083-1. PMID   9655946.
  4. 1 2 Joutel A, Ducros A, Alamowitch S, Cruaud C, Domenga V, Maréchal E, Vahedi K, Chabriat H, Bousser MG, Tournier-Lasserve E (December 1996). "A human homolog of bacterial acetolactate synthase genes maps within the CADASIL critical region". Genomics. 38 (2): 192–8. doi:10.1006/geno.1996.0615. PMID   8954801.
  5. ↑ "Entrez Gene:ILVBL ilvB (bacterial acetolactate synthase)-like".
  6. 1 2 "Acetolactate synthase, chloroplastic (P17597) < InterPro < EMBL-EBI".
  7. ↑ "SCOPe 2.07: Structural Classification of Proteins — extended".
  8. ↑ "ILV2 - Acetolactate synthase catalytic subunit, mitochondrial precursor - Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) - ILV2 gene & protein". www.uniprot.org.
  9. ↑ Dailey FE, Cronan JE (February 1986). "Acetohydroxy acid synthase I, a required enzyme for isoleucine and valine biosynthesis in Escherichia coli K-12 during growth on acetate as the sole carbon source". Journal of Bacteriology. 165 (2): 453–60. doi:10.1128/jb.165.2.453-460.1986. PMC   214440 . PMID   3511034.
  10. ↑ Bar-Ilan A, Balan V, Tittmann K, Golbik R, Vyazmensky M, Hübner G, Barak Z, Chipman DM (October 2001). "Binding and activation of thiamin diphosphate in acetohydroxyacid synthase". Biochemistry. 40 (39): 11946–54. doi:10.1021/bi0104524. PMID   11570896.
  11. ↑ "ALS - Acetolactate synthase, chloroplastic precursor - Arabidopsis thaliana (Mouse-ear cress) - ALS gene & protein". www.uniprot.org.
  12. ↑ Chen H, Saksa K, Zhao F, Qiu J, Xiong L (August 2010). "Genetic analysis of pathway regulation for enhancing branched-chain amino acid biosynthesis in plants". The Plant Journal. 63 (4): 573–83. doi:10.1111/j.1365-313X.2010.04261.x. PMID   20497381.
  13. ↑ Lee YT, Duggleby RG (June 2001). "Identification of the regulatory subunit of Arabidopsis thaliana acetohydroxyacid synthase and reconstitution with its catalytic subunit". Biochemistry. 40 (23): 6836–44. doi:10.1021/bi002775q. PMID   11389597.
  14. ↑ Mohammad Dezfulian, Curtis Foreman, Espanta Jalili, Mrinal Pal, Rajdeep K. Dhaliwal, Don Karl A. Roberto, Kathleen M. Imre, Susanne E. Kohalmi, and William L. Crosby. (2017). "Acetolactate synthase regulatory subunits play divergent and overlapping roles in branched-chain amino acid synthesis and Arabidopsis development". BMC Plant Biology. 17. doi: 10.1186/s12870-017-1022-6 . PMID   28388946.{{cite journal}}: CS1 maint: multiple names: authors list (link)
  15. ↑ Duggleby RG (May 1997). "Identification of an acetolactate synthase small subunit gene in two eukaryotes". Gene. 190 (2): 245–9. doi:10.1016/s0378-1119(97)00002-4. PMID   9197540.
  16. ↑ Valle J, Da Re S, Schmid S, Skurnik D, D'Ari R, Ghigo JM (January 2008). "The amino acid valine is secreted in continuous-flow bacterial biofilms". Journal of Bacteriology. 190 (1): 264–74. doi:10.1128/JB.01405-07. PMC   2223729 . PMID   17981982.
  17. ↑ Calvo JM, Matthews RG (September 1994). "The leucine-responsive regulatory protein, a global regulator of metabolism in Escherichia coli". Microbiological Reviews. 58 (3): 466–90. doi: 10.1128/mmbr.58.3.466-490.1994 . PMC   372976 . PMID   7968922.
  18. ↑ Pátek M (2007). "Branched-chain amino acids.". Amino Acid Biosynthesis: Pathways, Regulation and Metabolic Engineering. Microbiology Monographs. Vol. 5. Berlin, Heidelberg: Springer. pp. 129–162. doi:10.1007/7171_2006_070. ISBN   978-3-540-48596-4.
  19. ↑ Zhou Q, Liu W, Zhang Y, Liu KK (Oct 2007). "Action mechanisms of acetolactate synthase-inhibiting herbicides". Pesticide Biochemistry and Physiology. 89 (2): 89–96. Bibcode:2007PBioP..89...89Z. doi:10.1016/j.pestbp.2007.04.004.
  20. ↑ Heap I. "List of Herbicide Resistant Weeds by Herbicide Mode of Action". HRAC (Herbicide Resistance Action Committee). Retrieved 2022-03-30.
  21. ↑ Mitra A, Sarma SP (February 2008). "Escherichia coli ilvN interacts with the FAD binding domain of ilvB and activates the AHAS I enzyme". Biochemistry. 47 (6): 1518–31. doi:10.1021/bi701893b. PMID   18193896.
This page is based on this Wikipedia article
Text is available under the CC BY-SA 4.0 license; additional terms may apply.
Images, videos and audio are available under their respective licenses.