Piscivorin

Last updated

Piscivorin is a component of snake venom secreted by the Eastern Cottonmouth (Agkistrodon piscivorus piscivorus). [1] It is a member of the cysteine-rich secretory protein (CRISP) family, which blocks voltage-dependent calcium channels.

Contents

Etymology

The name of piscivorin comes from the snake species name piscivorus, which is derived from the Latin words pisces and vorare, meaning 'fish' and 'to devour' respectively.

Sources

Piscivorin is produced in the venom glands of the Eastern Cottonmouth snake (Agkistrodon piscivorus piscivorus), which populates the Eastern United States. [2] Typically, crude venom from the Eastern Cottonmouth contains approximately 1.25% of piscivorin. [1] [3]

Biochemistry

Piscivorin belongs to the cysteine-rich secretory protein (CRISP) family, which are secreted as single-chain proteins with molecular masses between 20 and 30 kDa. They display significant amino acid sequence homology. Sixteen cysteine residues, forming 8 disulfide bonds, are strictly conserved in CRISPs. [4] Ten of these cysteine residues are clustered into the C-terminal part of the protein. [3]

The molecular mass of piscivorin is 24.842 kDa. The nucleotide sequence of piscivorin cDNA spans 1323 bp, containing an open reading frame of 240 codons. [3]

Piscivorin has the following amino acid sequence. [5]

102030405060
MIAFIVLPILAAVLQQSSGSVDFDSESPRKPEIQNQIVDLHNSLRRSVNPTASNMLKMEW
708090100110120
YPEAAANAERWAYRCIESHSPRNSRVLGGIKCGENIYMSSIPIKWTEIIHAWHGENKNFK
130140150160170180
YGIGADPPNAVIGHFTQIVWYKSYLVGCAA AYCPSSEYSYFYVCQYCPAGNIIGKIATPY
190200210220230240
KSGPPCGDCP SACVNGLCTNPCTKEDKYTNCKSLVQQYGCQDKQMQSECSAICFCQNKII

Target and mode of action

Piscivorin reduces high potassium-evoked smooth muscle contraction, but does not inhibit caffeine-stimulated contraction of smooth muscle. [3] Since caffeine normally causes contraction through the release of Ca2+ from the sarcoplasmic reticulum, this differential effect indicates that piscivorin is an L-type calcium channel blocker. At a concentration of 1 μM, its effect on depolarization-induced smooth muscle contraction is weaker than of the related CRISP family toxins ablomin, triflin or latisemin. A sequence comparison of piscivorin and other CRISP family proteins suggests that the Glu186 residue is the crucial site for the blocking of the calcium channels. [1] [3]

Unlike some other CRISP family proteins, piscivorin does not block cyclic nucleotide-gated channels. [1]

Related Research Articles

<span class="mw-page-title-main">Smooth muscle</span> Involuntary non-striated muscle

Smooth muscle is an involuntary non-striated muscle, so-called because it has no sarcomeres and therefore no striations. It is divided into two subgroups, single-unit and multiunit smooth muscle. Within single-unit muscle, the whole bundle or sheet of smooth muscle cells contracts as a syncytium.

<i>Agkistrodon</i> Genus of snakes

Agkistrodon is a genus of venomous pit vipers commonly known as American moccasins. The genus is endemic to North America, ranging from the Southern United States to northern Costa Rica. Eight species are currently recognized, all of them monotypic and closely related. Common names include: cottonmouths, copperheads, and cantils.

<span class="mw-page-title-main">Conotoxin</span> Group of neurotoxins

A conotoxin is one of a group of neurotoxic peptides isolated from the venom of the marine cone snail, genus Conus.

Ophanin is a toxin found in the venom of the King Cobra, which lives throughout South East Asia. This toxin belongs to the cysteine-rich secretory protein (CRISP) family. Ophanin weakly blocks the contraction of smooth muscles elicited by high potassium-induced depolarization, suggesting that it inhibits voltage-dependent calcium channels.

A latrotoxin is a high-molecular mass neurotoxin found in the venom of spiders of the genus Latrodectus as well as at least one species of another genus in the same family, Steatoda nobilis. Latrotoxins are the main active components of the venom and are responsible for the symptoms of latrodectism.

<span class="mw-page-title-main">Mamushi</span> Species of snake

Gloydius blomhoffii, commonly known as the mamushi, Japanese moccasin, Japanese pit viper, Qichun snake, Salmusa or Japanese mamushi, is a venomous pit viper species found in Japan. It was once considered to have 4 subspecies, but it is now considered monotypic.

Taicatoxin (TCX) is a snake toxin that blocks voltage-dependent L-type calcium channels and small conductance Ca2+-activated K+ channels. The name taicatoxin (TAIpan + CAlcium + TOXIN) is derived from its natural source, the taipan snake, the site of its action, calcium channels, and from its function as a toxin. Taicatoxin was isolated from the venom of Australian taipan snake, Oxyuranus scutellatus scutellatus. TCX is a secreted protein, produced in the venom gland of the snake.

<span class="mw-page-title-main">Calciseptine</span> Neurotoxin

Calciseptine (CaS) is a natural neurotoxin isolated from the black mamba Dendroaspis p. polylepis venom. This toxin consists of 60 amino acids with four disulfide bonds. Calciseptine specifically blocks L-type calcium channels, but not other voltage-dependent Ca2+ channels such as N-type and T-type channels.

<span class="mw-page-title-main">Crotamine</span>

Crotamine is a toxin present in the venom of the South American rattlesnake. It is a 42-residue long protein containing 11 basic residues and 6 cysteines. It has also been isolated from the venom of North American prairie rattlesnake, Crotalus viridis viridis. It was first isolated and purified by Brazilian scientist José Moura Gonçalves, and later intensively studied by his group of collaborators at the Medical School of Ribeirão Preto of the University of São Paulo.

Ablomin is a toxin present in the venom of the Japanese Mamushi snake, which blocks L-type voltage-gated calcium channels.

Triflin is a cysteine-rich secretory protein (CRISP), which is excreted by the venom gland of the Habu snake. Triflin reduces high potassium-induced smooth muscle contraction, suggesting a blocking effect on L-type calcium channels.

Latisemin is a cysteine-rich secretory protein that can be isolated from the venom of the Black-banded sea krait, a sea snake indigenous to the warmer waters of the western Pacific Ocean. It is a toxin that inhibits cyclic nucleotide-gated ion channels and blocks L-type calcium channels, thereby reducing smooth muscle contraction.

<span class="mw-page-title-main">Cysteine-rich secretory protein</span>

Cysteine-rich secretory proteins, often abbreviated as CRISPs, are a group of glycoproteins. They are a subgroup of the CRISP, antigen 5 and Pr-1 (CAP) protein superfamily and also contain a domain related to the ShK toxins. They are substantially implicated in the functioning of the mammalian reproductive system. CRISPs are also found in a variety of snake venoms where they inhibit both smooth muscle contraction and cyclic nucleotide-gated ion channels.

<span class="mw-page-title-main">Cysteine-rich secretory protein superfamily</span>

The CAP superfamily is a large superfamily of secreted proteins that are produced by a wide range of organisms, including prokaryotes and non-vertebrate eukaryotes.

Helothermine is a toxin from the venom of the Mexican beaded lizard Heloderma horridum horridum. Helothermine inhibits ryanodine receptors, calcium channels and potassium channels. Helothermine can cause lethargy, partial paralysis of rear limbs and lowering of the body temperature.

α-Neurotoxin Group of neurotoxic peptides found in the venom of snakes

α-Neurotoxins are a group of neurotoxic peptides found in the venom of snakes in the families Elapidae and Hydrophiidae. They can cause paralysis, respiratory failure, and death. Members of the three-finger toxin protein family, they are antagonists of post-synaptic nicotinic acetylcholine receptors (nAChRs) in the neuromuscular synapse that bind competitively and irreversibly, preventing synaptic acetylcholine (ACh) from opening the ion channel. Over 100 α-neurotoxins have been identified and sequenced.

Huwentoxins (HWTX) are a group of neurotoxic peptides found in the venom of the Chinese bird spider Haplopelma schmidti. The species was formerly known as Haplopelma huwenum, Ornithoctonus huwena and Selenocosmia huwena. While structural similarity can be found among several of these toxins, HWTX as a group possess high functional diversity.

Tamulotoxin is a venomous neurotoxin from the Indian Red Scorpion.

<span class="mw-page-title-main">Three-finger toxin</span> Toxin protein

Three-finger toxins are a protein superfamily of small toxin proteins found in the venom of snakes. Three-finger toxins are in turn members of a larger superfamily of three-finger protein domains which includes non-toxic proteins that share a similar protein fold. The group is named for its common structure consisting of three beta strand loops connected to a central core containing four conserved disulfide bonds. The 3FP protein domain has no enzymatic activity and is typically between 60-74 amino acid residues long. Despite their conserved structure, three-finger toxin proteins have a wide range of pharmacological effects. Most members of the family are neurotoxins that act on cholinergic intercellular signaling; the alpha-neurotoxin family interacts with muscle nicotinic acetylcholine receptors (nAChRs), the kappa-bungarotoxin family with neuronal nAChRs, and muscarinic toxins with muscarinic acetylcholine receptors (mAChRs).

GTx1-15 is a toxin from the Chilean tarantula venom that acts as both a voltage-gated calcium channel blocker and a voltage-gated sodium channel blocker.

References

  1. 1 2 3 4 Yamazaki, Yasuo; Hyodo, Fumiko; Morita, Takashi (2003). "Wide distribution of cysteine-rich secretory proteins in snake venoms: Isolation and cloning of novel snake venom cysteine-rich secretory proteins". Archives of Biochemistry and Biophysics. 412 (1): 133–41. doi:10.1016/S0003-9861(03)00028-6. PMID   12646276.
  2. Campbell, J.A., & Lamar, W. W. (2004). The Venomous Reptiles of the Western Hemisphere. Ithaca and London:Comstock Publishing Associates. Vol. II, p. 271.
  3. 1 2 3 4 5 Yamazaki, Yasuo; Morita, Takashi (2004). "Structure and function of snake venom cysteine-rich secretory proteins". Toxicon. 44 (3): 227–31. doi:10.1016/j.toxicon.2004.05.023. PMID   15302528.
  4. Guo, Min; Teng, Maikun; Niu, Liwen; Liu, Qun; Huang, Qingqiu; Hao, Quan (2004). "Crystal Structure of the Cysteine-rich Secretory Protein Stecrisp Reveals That the Cysteine-rich Domain Has a K+ Channel Inhibitor-like Fold". Journal of Biological Chemistry. 280 (13): 12405–12. doi: 10.1074/jbc.M413566200 . PMID   15596436.
  5. "Piscivorin". UniProt Consortium. 2010. Retrieved 27 October 2010.